PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00055g02010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family NF-YB
Protein Properties Length: 183aa    MW: 20323.7 Da    PI: 5.3398
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00055g02010.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB181.47.7e-5721116297
                     NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 
                               reqdrflPianvsrimkk+lPanakiskdake+vqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+y+eplkvy
  Peinf101Scf00055g02010.1  21 REQDRFLPIANVSRIMKKALPANAKISKDAKEVVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYIEPLKVY 105
                               89*********************************************************************************** PP

                     NF-YB  87 lkkyrelegek 97 
                               l+++r+leg+k
  Peinf101Scf00055g02010.1 106 LQRFRDLEGQK 116
                               ********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.6E-5414121IPR009072Histone-fold
SuperFamilySSF471131.55E-3923120IPR009072Histone-fold
PfamPF008086.6E-282690IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006159.1E-215472No hitNo description
PROSITE patternPS0068505773IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006159.1E-217391No hitNo description
PRINTSPR006159.1E-2192110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MADSDNESGG HRDNSSESSL REQDRFLPIA NVSRIMKKAL PANAKISKDA KEVVQECVSE  60
FISFITGEAS DKCQREKRKT INGDDLLWAM TTLGFEEYIE PLKVYLQRFR DLEGQKSAMA  120
GIQDKDSDCH VVGDMSGGGG GVYDYGRMMM MGQHQGNNQM YSQATGMYNQ TAGSRGPDMG  180
RQR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-4719111193NF-YB
4awl_B1e-4719111294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-4719111294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009773122.15e-95PREDICTED: nuclear transcription factor Y subunit B-3-like
RefseqXP_016480254.15e-95PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233101e-73NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLK4CHM82e-91K4CHM8_SOLLC; Uncharacterized protein
TrEMBLM1C0B32e-91M1C0B3_SOLTU; Uncharacterized protein
STRINGSolyc07g065500.1.17e-91(Solanum lycopersicum)
STRINGPGSC0003DMT4000570657e-91(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.14e-75nuclear factor Y, subunit B3